PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_002608-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 349aa    MW: 39691.7 Da    PI: 10.0596
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_002608-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.6e-182166147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
  AHYPO_002608-RA 21 RGHWRPAEDEKLRKLVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 66
                     899*****************************.***********996 PP

2Myb_DNA-binding58.41.6e-1873116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++T+eE+e+l+ a++ +G++ W++I+r ++ gRt++ +k++w+ 
  AHYPO_002608-RA  73 RKPFTEEEEERLLTAHRIHGNK-WALISRLFP-GRTDNAVKNHWHV 116
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.5871671IPR017930Myb domain
SuperFamilySSF466899.17E-3019114IPR009057Homeodomain-like
SMARTSM007173.9E-152069IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-272274IPR009057Homeodomain-like
CDDcd001676.39E-142465No hitNo description
PfamPF139219.2E-182484No hitNo description
SMARTSM007174.5E-1672120IPR001005SANT/Myb domain
PROSITE profilePS5129420.72172122IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-2175120IPR009057Homeodomain-like
CDDcd001674.56E-784115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MEDSCGNSSD NEMRSSSSCP RGHWRPAEDE KLRKLVEQYG PQNWNSIAEK LQGRSGKSCR  60
LRWFNQLDPR INRKPFTEEE EERLLTAHRI HGNKWALISR LFPGRTDNAV KNHWHVIMAR  120
MQRERSKQQS TTSKQRNIIT STTNLSSTHT PVHDFLSKIP KSQNNNNHNL FKFENSLIVT  180
TSLNYNNNNN NNNNNNNNTA APCWSFTPQG MSMEKFRASS SSNWVNNNSI FEQSKRFYGS  240
SSILSDTKIS QYGGFCGSYG VNFHKDKNNS KVIIPSYGPL ISSSHTMNAT THGAMVRKRS  300
SLFLERIEKE VDDHGEGNNN NNNNNNNNNN NNSKEIHFID FLGVGISS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C5e-302112058157MYB PROTO-ONCOGENE PROTEIN
1h88_C5e-302112058157MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692619.11e-121PREDICTED: transcription factor LAF1-like
TrEMBLA0A0J8E9A41e-121A0A0J8E9A4_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.15e-67myb domain protein 52